PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8649
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 272aa    MW: 30809.9 Da    PI: 10.2026
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8649genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.91.3e-25149198352
                    RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               ++i+++dl kyF++p+ +A+k+L+v++TvLKr+CR++G++RWPhRkiksl
  Tp57577_TGAC_v2_mRNA8649 149 AKITVSDLVKYFDMPLLEASKKLNVGTTVLKRRCRELGLPRWPHRKIKSL 198
                               78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.44133219IPR003035RWP-RK domain
PfamPF020424.7E-22150198IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEEDSLKIAL EVLEELKMGK NEIGRGDSKV VVANSSMVEV MGGVLNDGQS IKKKKNNIEV  60
KDIYPLKYPI CPKCKGEFFT FSAVIEHLLK NPNCASCGTS NPHQLVDLNK GADEVQQMEI  120
EGSSNAAAAP KPAECFVGKK KRATRDHVAK ITVSDLVKYF DMPLLEASKK LNVGTTVLKR  180
RCRELGLPRW PHRKIKSLDT LIHDLHQEEA AHKEMKNKAA AMAVRRKQKM VESEKERIEK  240
KPFIAIKSET RRLRQYVFKR RYHARVMEKQ N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612350.18e-65plant regulator RWP-RK family protein
RefseqXP_004512265.28e-62PREDICTED: uncharacterized protein LOC101497150
TrEMBLG7K0419e-65G7K041_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA11G09080.15e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.15e-43RWP-RK domain-containing protein